Project name: query_structure

Status: done

Started: 2026-03-17 01:22:14
Settings
Chain sequence(s) A: VSSVPTKLEVVAATPTSLLISWDAPAVTVDHYVITYGETGGNSPVQEFEVPGSKSTATISGLSPGVDYTITVYAGHFWYGYQYWSPISINYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:30)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:30)
Show buried residues

Minimal score value
-2.6978
Maximal score value
3.1592
Average score
-0.2816
Total score value
-26.1892

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 V A 1.8000
2 S A 0.8811
3 S A 0.9195
4 V A 0.8189
5 P A 0.0000
6 T A -1.5698
7 K A -2.6978
8 L A 0.0000
9 E A -1.9177
10 V A 0.1116
11 V A 1.5515
12 A A 0.9111
13 A A 0.3343
14 T A -0.1957
15 P A -0.8065
16 T A -0.5354
17 S A -0.3097
18 L A 0.0000
19 L A 0.7895
20 I A 0.0000
21 S A -0.9560
22 W A 0.0000
23 D A -2.6093
24 A A -1.2045
25 P A 0.0802
26 A A 0.4462
27 V A 0.7923
28 T A 0.0930
29 V A -0.3028
30 D A -1.3695
31 H A -1.3937
32 Y A 0.0000
33 V A -0.6820
34 I A 0.0000
35 T A -0.5789
36 Y A -0.2745
37 G A 0.0000
38 E A -1.3485
39 T A -1.2471
40 G A -1.2445
41 G A -1.4274
42 N A -1.5488
43 S A -0.8616
44 P A -0.3072
45 V A 0.4725
46 Q A -0.7803
47 E A -1.8297
48 F A -1.2950
49 E A -1.9060
50 V A 0.0000
51 P A -1.6355
52 G A -1.6866
53 S A -1.4432
54 K A -2.1336
55 S A -1.4740
56 T A -0.7688
57 A A 0.0000
58 T A 0.2554
59 I A 0.0000
60 S A -0.4736
61 G A -0.6876
62 L A 0.0000
63 S A -0.8462
64 P A -0.9930
65 G A -1.0815
66 V A -0.9139
67 D A -1.8593
68 Y A 0.0000
69 T A -0.7873
70 I A 0.0000
71 T A -0.0575
72 V A 0.0000
73 Y A 0.5082
74 A A 0.0000
75 G A 0.0000
76 H A 0.0000
77 F A 2.9562
78 W A 3.1592
79 Y A 2.5621
80 G A 1.6975
81 Y A 2.5943
82 Q A 1.7646
83 Y A 2.0728
84 W A 1.3682
85 S A 0.0000
86 P A 0.3295
87 I A 0.1947
88 S A -0.3410
89 I A -0.5465
90 N A -1.7316
91 Y A -1.4640
92 R A -2.3392
93 T A -1.1898
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018