Project name: C dog ion

Chain sequence(s)	A: GIPFFPSSLKRLLIIVVVIELVVKVIVGALLMGL
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:32)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:33)

• Minimal score value: -0.6108
• Maximal score value: 5.0272
• Average score: 2.5322
• Total score value: 86.096

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	G	A	0.7475
2	I	A	2.2910
3	P	A	1.6902
4	F	A	2.4260
5	F	A	1.2997
6	P	A	0.0663
7	S	A	-0.5155
8	S	A	-0.6108
9	L	A	0.6479
10	K	A	-0.2262
11	R	A	-0.2444
12	L	A	2.2921
13	L	A	3.1846
14	I	A	4.1548
15	I	A	4.8331
16	V	A	4.4284
17	V	A	4.9418
18	V	A	5.0272
19	I	A	4.5074
20	E	A	2.2636
21	L	A	3.5018
22	V	A	3.9145
23	V	A	3.0727
24	K	A	1.5660
25	V	A	3.4752
26	I	A	3.8319
27	V	A	3.4161
28	G	A	2.7931
29	A	A	3.1381
30	L	A	3.6749
31	L	A	3.5634
32	M	A	2.8508
33	G	A	1.7822
34	L	A	2.3106