Project name: gfp

Status: error

Started: 2026-03-05 10:07:58
Settings
Chain sequence(s) A: SSHHHHHHSSGLVPGGSHMGGTSSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATIGKLTLKFISTTGKLPVPWPTLVTTLGGGVQAFSRYPDHMMKRHDFFKSAMPEGYVQERTISFKDDGKYKTRAVVKFEGDTLVNRIELKGTDFKEDGNILGHKLEYNFNSHNVYITADKQKNGIKANFTVRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQTKLS
B: SSHHHHHHSSGLVPGGSHMGGTSSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATIGKLTLKFISTTGKLPVPWPTLVTTLGGGVQAFSRYPDHMMKRHDFFKSAMPEGYVQERTISFKDDGKYKTRAVVKFEGDTLVNRIELKGTDFKEDGNILGHKLEYNFNSHNVYITADKQKNGIKANFTVRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQTKLS
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations Yes
Error log 
One of Aggrescan3D modules (OptParser) encountered an error. 
Your mutation LE-10A was provided in wrong format. Correct formatting is <Oldres><Newres><ID><chain>. For example MW1A. Mind the capital letters. One of Aggrescan3D modules (OptParser) encountered an error. 
Your mutation LK-10A was provided in wrong format. Correct formatting is <Oldres><Newres><ID><chain>. For example MW1A. Mind the capital letters. One of Aggrescan3D modules (OptParser) encountered an error. 
Your mutation LD-10A was provided in wrong format. Correct formatting is <Oldres><Newres><ID><chain>. For example MW1A. Mind the capital letters. One of Aggrescan3D modules (OptParser) encountered an error. 
Your mutation LR-10A was provided in wrong format. Correct formatting is <Oldres><Newres><ID><chain>. For example MW1A. Mind the capital letters.
Laboratory of Theory of Biopolymers 2018