Project name: query_structure

Status: done

Started: 2026-03-16 23:06:32
Settings
Chain sequence(s) A: ECLGFGKGCNPSNDQCCKSSNLVCSRKHRWCKYEI
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:55)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:55)
Show buried residues

Minimal score value
-3.9252
Maximal score value
1.2196
Average score
-1.1745
Total score value
-41.1081

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E A -1.8528
2 C A -0.6191
3 L A -0.3852
4 G A 0.1206
5 F A 1.2196
6 G A -0.5613
7 K A -1.8814
8 G A -1.7441
9 C A 0.0000
10 N A -2.4069
11 P A -2.3562
12 S A -1.7440
13 N A -1.9710
14 D A -1.9904
15 Q A -1.9625
16 C A 0.0000
17 C A -0.8416
18 K A -2.0825
19 S A -1.1364
20 S A -0.6978
21 N A -0.9542
22 L A 0.0000
23 V A -0.6574
24 C A 0.0000
25 S A 0.0000
26 R A -3.6340
27 K A -3.5344
28 H A -3.5525
29 R A -3.9252
30 W A -2.1588
31 C A 0.0000
32 K A -0.6762
33 Y A 0.4042
34 E A -0.7051
35 I A 1.1785
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018