Project name: ff9aa8f72c7a109

Chain sequence(s)	A: EVQLVESGGGLVQPGGSLRLSCAASGSFNAMGWLRQAPGKEREFVAAISSSGNTYYADSVKGRFTISRDNSKNTLYLQMNSLRPEDTAVYYCATGGAGLTYPSGFSYWGQGTLVTVSS
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:15)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:16)

• Minimal score value: -3.6755
• Maximal score value: 1.6441
• Average score: -0.6588
• Total score value: -77.7349

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	A	-2.1039
2	V	A	-1.0477
3	Q	A	-1.2375
4	L	A	0.0000
5	V	A	0.5079
6	E	A	0.0000
7	S	A	-0.2284
8	G	A	-0.6154
9	G	A	0.1552
10	G	A	0.6935
11	L	A	1.4038
12	V	A	-0.0104
13	Q	A	-1.3005
14	P	A	-1.4756
15	G	A	-1.3371
16	G	A	-0.8759
17	S	A	-1.0100
18	L	A	-0.8446
19	R	A	-2.0400
20	L	A	0.0000
21	S	A	-0.4308
22	C	A	0.0000
23	A	A	-0.3598
24	A	A	0.0000
25	S	A	-1.1835
26	G	A	-1.2541
27	S	A	-0.7636
28	F	A	-0.3563
29	N	A	-0.4525
30	A	A	0.0000
31	M	A	0.0000
32	G	A	0.0000
33	W	A	0.0000
34	L	A	-0.2825
35	R	A	0.0000
36	Q	A	-1.8239
37	A	A	-1.6504
38	P	A	-1.3888
39	G	A	-1.9583
40	K	A	-3.4020
41	E	A	-3.6755
42	R	A	-2.9179
43	E	A	-2.4472
44	F	A	-0.6798
45	V	A	0.0000
46	A	A	0.0000
47	A	A	0.0000
48	I	A	0.0000
49	S	A	-0.7494
50	S	A	-0.8842
51	S	A	-0.8964
52	G	A	-1.1558
53	N	A	-1.4389
54	T	A	-0.4151
55	Y	A	0.0887
56	Y	A	-0.4943
57	A	A	-1.2185
58	D	A	-2.3225
59	S	A	-1.7431
60	V	A	0.0000
61	K	A	-2.5079
62	G	A	-1.7722
63	R	A	-1.3553
64	F	A	0.0000
65	T	A	-0.7343
66	I	A	0.0000
67	S	A	-0.6447
68	R	A	-1.3369
69	D	A	-2.0296
70	N	A	-2.5898
71	S	A	-2.0938
72	K	A	-2.8253
73	N	A	-2.4264
74	T	A	-1.4015
75	L	A	0.0000
76	Y	A	-0.4439
77	L	A	0.0000
78	Q	A	-1.0959
79	M	A	0.0000
80	N	A	-1.3832
81	S	A	-1.1720
82	L	A	0.0000
83	R	A	-2.0621
84	P	A	-1.8133
85	E	A	-2.2500
86	D	A	0.0000
87	T	A	-0.3717
88	A	A	0.0000
89	V	A	0.7380
90	Y	A	0.0000
91	Y	A	0.3348
92	C	A	0.0000
93	A	A	0.0000
94	T	A	0.0000
95	G	A	0.0000
96	G	A	-0.5400
97	A	A	-0.4648
98	G	A	-0.5637
99	L	A	-0.3523
100	T	A	-0.1043
101	Y	A	0.4121
102	P	A	0.0789
103	S	A	-0.3561
104	G	A	-0.4189
105	F	A	0.2147
106	S	A	0.4108
107	Y	A	1.1721
108	W	A	1.0024
109	G	A	0.0822
110	Q	A	-0.7333
111	G	A	0.1329
112	T	A	0.5652
113	L	A	1.6441
114	V	A	0.0000
115	T	A	0.3974
116	V	A	0.0000
117	S	A	-0.7760
118	S	A	-0.6783