Project name: Hman1

Status: done

Started: 2026-04-26 02:10:04
Settings
Chain sequence(s) B: MSYTGCTESGQNYCLCVGSDICGDGKHCEMDGSENKCVDGEGTPKRQTSGPSDFEEFSLDDIEQK
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:08)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:08)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:08)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:08)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:08)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:16)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:17)
Show buried residues

Minimal score value
-3.4807
Maximal score value
1.0971
Average score
-1.3261
Total score value
-86.1987

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M B 1.0971
2 S B 0.7060
3 Y B 0.7172
4 T B 0.1142
5 G B -0.3440
6 C B 0.0000
7 T B -1.0120
8 E B -1.4252
9 S B -1.6047
10 G B -1.2743
11 Q B 0.0000
12 N B 0.0000
13 Y B -0.4989
14 C B 0.0000
15 L B 0.1667
16 C B 0.0000
17 V B -0.4110
18 G B -0.9173
19 S B -0.6954
20 D B -1.0587
21 I B 0.0623
22 C B 0.0000
23 G B -1.6887
24 D B -2.9235
25 G B -2.9873
26 K B -3.4807
27 H B -2.6780
28 C B 0.0000
29 E B -2.4782
30 M B -2.0875
31 D B -2.9176
32 G B -1.8404
33 S B -2.1135
34 E B -2.9691
35 N B -2.4976
36 K B -2.8131
37 C B -1.6886
38 V B -1.8047
39 D B -3.2664
40 G B -2.7223
41 E B -3.3019
42 G B -2.2651
43 T B -1.4619
44 P B -1.6528
45 K B -1.8176
46 R B -2.7002
47 Q B -2.3913
48 T B -1.2346
49 S B -1.1428
50 G B -1.0837
51 P B -0.7525
52 S B -1.0582
53 D B -1.7206
54 F B -0.1989
55 E B -1.9392
56 E B -1.4202
57 F B 0.2462
58 S B -0.1154
59 L B 0.2729
60 D B -1.5847
61 D B -1.5166
62 I B -0.3750
63 E B -2.5096
64 Q B -2.5277
65 K B -2.6121
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018