Project name: query_structure

Status: done

Started: 2026-03-17 01:20:34
Settings
Chain sequence(s) A: VSSVPTKLEVVAATPTSLLISWDAPAVTVDFYFITYGETGGNSPVQEFTVPGSKSTATISGLKPGVDYTITVYAWTGYPSQIKASPISIYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:02)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:27)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:28)
Show buried residues

Minimal score value
-2.553
Maximal score value
1.7629
Average score
-0.3449
Total score value
-31.7354

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 V A 1.7629
2 S A 0.7343
3 S A 0.5203
4 V A 0.0990
5 P A 0.0000
6 T A -1.5624
7 K A -2.5530
8 L A 0.0000
9 E A -1.4835
10 V A 0.4448
11 V A 1.6667
12 A A 0.9736
13 A A 0.2741
14 T A -0.4020
15 P A -1.1010
16 T A -1.0079
17 S A -0.5483
18 L A 0.0000
19 L A 0.8268
20 I A 0.0000
21 S A -0.8299
22 W A 0.0000
23 D A -2.4486
24 A A -1.1183
25 P A 0.0000
26 A A 0.4918
27 V A 0.6615
28 T A -0.1115
29 V A -0.5046
30 D A -1.5729
31 F A -0.3979
32 Y A 0.0000
33 F A 0.6711
34 I A 0.0000
35 T A -0.3180
36 Y A 0.0000
37 G A 0.0000
38 E A -1.2165
39 T A -0.7642
40 G A -1.1181
41 G A -1.2620
42 N A -1.5128
43 S A -0.8089
44 P A -0.2987
45 V A 0.4564
46 Q A -0.8242
47 E A -1.4603
48 F A -0.4578
49 T A 0.1878
50 V A 0.0000
51 P A -0.8892
52 G A -1.0220
53 S A -1.3280
54 K A -2.1143
55 S A -1.3162
56 T A -0.6967
57 A A 0.0000
58 T A 0.2665
59 I A 0.0000
60 S A -0.6643
61 G A -1.0453
62 L A 0.0000
63 K A -2.0932
64 P A -1.5269
65 G A -1.2628
66 V A -1.0471
67 D A -1.0813
68 Y A 0.0000
69 T A -0.0091
70 I A 0.0000
71 T A 0.1033
72 V A 0.0000
73 Y A 0.7830
74 A A 0.4045
75 W A 0.4945
76 T A -0.0495
77 G A -0.1183
78 Y A 0.9951
79 P A 0.3282
80 S A -0.0666
81 Q A -0.3393
82 I A 0.7565
83 K A -0.7562
84 A A -0.0237
85 S A -0.2122
86 P A -0.2443
87 I A -0.2020
88 S A 0.0634
89 I A 0.0995
90 Y A 0.3625
91 R A -1.3234
92 T A -1.0483
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018