CABS-dock: YWHAG_ABI3_D225

Project name: YWHAG_ABI3_D225_1433

Status: done

submitted: 2025-04-13 00:24:24, status changed: 2025-04-13 14:32:42

Project settings

Protein sequence(s)	MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDDDGGEGNN input pdb
Peptide sequence	GVGGAPDPKGQ
Simulation mc cycles	200
Peptide secondary structure psipred	CCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	27.8665	8.89957	33.643	248
cluster_2.pdb ( medoid)	24.3023	4.15599	12.048	101
cluster_3.pdb ( medoid)	22.8257	4.46865	27.1995	102
cluster_4.pdb ( medoid)	21.0193	4.18662	10.1991	88
cluster_5.pdb ( medoid)	18.2811	6.61886	19.9341	121
cluster_6.pdb ( medoid)	14.9189	5.89858	28.1343	88
cluster_7.pdb ( medoid)	12.2341	6.94777	25.7096	85
cluster_8.pdb ( medoid)	12.2282	7.27828	21.5149	89
cluster_9.pdb ( medoid)	3.741	9.8904	25.0896	37
cluster_10.pdb ( medoid)	3.66496	11.187	29.5488	41