Project name: 13e824e81c6e89c

Status: done

submitted: 2026-06-17 06:48:35, status changed: 2026-06-17 14:13:41

Project settings
Protein sequence(s) VKDFLSQLRSSNRRFSIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPGPRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLAPSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK input pdb
Peptide sequence KRLVQVFGSNTYRLHHHHHHHHHHH
Simulation mc cycles50
Peptide secondary structure psipred CCEEEECCCCCEECCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 21.4711 5.82177 24.199 125
cluster_2.pdb ( medoid) 15.4274 9.13958 38.4758 141
cluster_3.pdb ( medoid) 13.0711 6.65588 28.5864 87
cluster_4.pdb ( medoid) 11.8427 9.87947 28.1103 117
cluster_5.pdb ( medoid) 6.78953 15.3177 34.5854 104
cluster_6.pdb ( medoid) 6.72607 15.6109 31.7591 105
cluster_7.pdb ( medoid) 6.0113 15.9699 32.4179 96
cluster_8.pdb ( medoid) 5.56444 17.0727 38.2311 95
cluster_9.pdb ( medoid) 5.18406 10.2236 23.9221 53
cluster_10.pdb ( medoid) 4.79465 16.0596 33.424 77