Project name: 1507ec257e65b04

Status: done

submitted: 2026-07-01 10:15:22, status changed: 2026-07-01 13:13:11

Project settings
Protein sequence(s) LATDKDKLSYSIGADLGKNFKNQGIDVNPEAMAKGMQDAMSGAQLALTEQQMKDVLNKFQKDLMAKRTAEFNKKADENKVKGEAFLTENKNKPGVVVLPSGLQYKVINSGNGVKPGKSDTVTVEYTGRLIDGTVFDSTEKTGKPATFQVSQVIPGWTEALQLMPAGSTWEIYVPSGLAYGPRSVGGPIGPNETLIFKIHLISVKK input pdb
Peptide sequence DGSFLV
Simulation mc cycles50
Peptide secondary structure psipred CCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 54.5394 5.04222 25.7099 275
cluster_2.pdb ( medoid) 33.3366 5.33948 22.4927 178
cluster_3.pdb ( medoid) 16.6838 5.51434 29.3517 92
cluster_4.pdb ( medoid) 15.3515 5.47178 10.17 84
cluster_5.pdb ( medoid) 11.9129 7.303 27.4703 87
cluster_6.pdb ( medoid) 8.14382 13.1388 33.8874 107
cluster_7.pdb ( medoid) 5.93686 7.41133 18.6908 44
cluster_8.pdb ( medoid) 5.70809 9.28507 32.8815 53
cluster_9.pdb ( medoid) 5.63435 11.1814 24.1682 63
cluster_10.pdb ( medoid) 1.06382 15.9801 34.5813 17