CABS-dock: 1507ec257e65b04

Project name: 1507ec257e65b04

Status: done

submitted: 2026-07-01 10:15:22, status changed: 2026-07-01 13:13:11

Project settings

Protein sequence(s)	LATDKDKLSYSIGADLGKNFKNQGIDVNPEAMAKGMQDAMSGAQLALTEQQMKDVLNKFQKDLMAKRTAEFNKKADENKVKGEAFLTENKNKPGVVVLPSGLQYKVINSGNGVKPGKSDTVTVEYTGRLIDGTVFDSTEKTGKPATFQVSQVIPGWTEALQLMPAGSTWEIYVPSGLAYGPRSVGGPIGPNETLIFKIHLISVKK input pdb
Peptide sequence	DGSFLV
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	54.5394	5.04222	25.7099	275
cluster_2.pdb ( medoid)	33.3366	5.33948	22.4927	178
cluster_3.pdb ( medoid)	16.6838	5.51434	29.3517	92
cluster_4.pdb ( medoid)	15.3515	5.47178	10.17	84
cluster_5.pdb ( medoid)	11.9129	7.303	27.4703	87
cluster_6.pdb ( medoid)	8.14382	13.1388	33.8874	107
cluster_7.pdb ( medoid)	5.93686	7.41133	18.6908	44
cluster_8.pdb ( medoid)	5.70809	9.28507	32.8815	53
cluster_9.pdb ( medoid)	5.63435	11.1814	24.1682	63
cluster_10.pdb ( medoid)	1.06382	15.9801	34.5813	17