Project name: 19d4b49990573b7

Status: done

submitted: 2026-07-23 05:46:52, status changed: 2026-07-23 10:20:13

Project settings
Protein sequence(s) LYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKK input pdb
Peptide sequence TTDHISAAGPW
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 25.3873 5.63275 33.5359 143
cluster_2.pdb ( medoid) 19.8175 9.18378 30.0255 182
cluster_3.pdb ( medoid) 13.1904 12.8123 34.8294 169
cluster_4.pdb ( medoid) 11.5959 9.83109 21.0096 114
cluster_5.pdb ( medoid) 11.4817 7.6644 30.8169 88
cluster_6.pdb ( medoid) 10.8381 7.47366 29.749 81
cluster_7.pdb ( medoid) 6.12075 12.09 30.4706 74
cluster_8.pdb ( medoid) 3.34942 12.2409 29.2092 41
cluster_9.pdb ( medoid) 3.22553 14.8813 31.841 48
cluster_10.pdb ( medoid) 2.81053 21.3483 46.1915 60