CABS-dock: 1bc7ea5343745dc

Project name: 1bc7ea5343745dc

Status: done

submitted: 2026-04-12 11:20:07, status changed: 2026-04-12 15:44:24

Project settings

Protein sequence(s)	VKDFLSQLRSSNRRFSIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPGPRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLAPSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK input pdb
Peptide sequence	RRRVQLFGSNDARRY
Simulation mc cycles	50
Peptide secondary structure psipred	CCCEEECCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	29.4308	3.60167	26.3728	106
cluster_2.pdb ( medoid)	21.9141	5.5672	35.8233	122
cluster_3.pdb ( medoid)	17.2016	8.08063	27.9674	139
cluster_4.pdb ( medoid)	12.9107	13.3223	36.9888	172
cluster_5.pdb ( medoid)	11.472	10.7218	39.0988	123
cluster_6.pdb ( medoid)	8.27499	6.64653	27.187	55
cluster_7.pdb ( medoid)	7.91185	8.46831	32.862	67
cluster_8.pdb ( medoid)	6.65064	12.3296	26.3335	82
cluster_9.pdb ( medoid)	5.5028	14.9015	41.0026	82
cluster_10.pdb ( medoid)	3.59147	14.4788	29.9515	52