CABS-dock: 1c74239e980cecf

Project name: 1c74239e980cecf

Status: done

submitted: 2026-03-15 13:53:34, status changed: 2026-03-15 16:59:42

Project settings

Protein sequence(s)	APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence	IKIWFQNRRMKWGGVQVFGSNTY
Simulation mc cycles	50
Peptide secondary structure psipred	CCEEEECCCCCCCCEEEECCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	27.0504	4.51009	23.1905	122
cluster_2.pdb ( medoid)	16.6732	10.0161	26.6758	167
cluster_3.pdb ( medoid)	10.9634	7.0234	27.3994	77
cluster_4.pdb ( medoid)	10.1936	13.8322	28.3531	141
cluster_5.pdb ( medoid)	8.17852	8.06992	27.205	66
cluster_6.pdb ( medoid)	7.85103	14.393	26.094	113
cluster_7.pdb ( medoid)	7.14864	14.9679	26.6191	107
cluster_8.pdb ( medoid)	6.75711	12.1354	26.4739	82
cluster_9.pdb ( medoid)	5.68381	12.8435	27.985	73
cluster_10.pdb ( medoid)	3.79851	13.6896	26.3411	52