CABS-dock: 1c82d74c0dd1149

Project name: 1c82d74c0dd1149

Status: done

submitted: 2026-07-08 09:33:27, status changed: 2026-07-08 14:19:52

Project settings

Protein sequence(s)	GSHSLRYFYTAVSRPGLGEPRFIIVGYVDDTQFVRFDSDAGDPRVEPRARWVEQEGPEYWDQETRKAKDHAQFFRLGLNTLRGYYNQSEAGSHTLQWMYGCDVGPDGRLLRGFWQFGYEGRDYIALNEDLRSWTAADTAAQISKRKWEAADVAERQRNYLEGTCVEWLPRYLENGKDTLLRADPPKAHVTHHPISGREVTLRCWALGFYPEEISLTWQRNGEDQTQDMELVETRPSGDGTFQKWVALVVPSGEEQRYTCSVQHEGLQEPLTLRWEP input pdb
Peptide sequence	IAVTHTGKL
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	51.9862	3.34704	25.2296	174
cluster_2.pdb ( medoid)	47.0013	2.48929	26.8027	117
cluster_3.pdb ( medoid)	30.9539	4.49055	29.4833	139
cluster_4.pdb ( medoid)	21.8418	5.12778	41.811	112
cluster_5.pdb ( medoid)	15.2568	7.14436	41.265	109
cluster_6.pdb ( medoid)	12.8732	5.6707	12.5812	73
cluster_7.pdb ( medoid)	8.37914	9.07014	44.8298	76
cluster_8.pdb ( medoid)	8.04747	8.94691	38.4361	72
cluster_9.pdb ( medoid)	4.1531	11.7984	35.7533	49
cluster_10.pdb ( medoid)	3.73197	21.1685	54.5739	79