Project name: 1c82d74c0dd1149

Status: done

submitted: 2026-07-08 09:33:27, status changed: 2026-07-08 14:19:52

Project settings
Protein sequence(s) GSHSLRYFYTAVSRPGLGEPRFIIVGYVDDTQFVRFDSDAGDPRVEPRARWVEQEGPEYWDQETRKAKDHAQFFRLGLNTLRGYYNQSEAGSHTLQWMYGCDVGPDGRLLRGFWQFGYEGRDYIALNEDLRSWTAADTAAQISKRKWEAADVAERQRNYLEGTCVEWLPRYLENGKDTLLRADPPKAHVTHHPISGREVTLRCWALGFYPEEISLTWQRNGEDQTQDMELVETRPSGDGTFQKWVALVVPSGEEQRYTCSVQHEGLQEPLTLRWEP input pdb
Peptide sequence IAVTHTGKL
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 51.9862 3.34704 25.2296 174
cluster_2.pdb ( medoid) 47.0013 2.48929 26.8027 117
cluster_3.pdb ( medoid) 30.9539 4.49055 29.4833 139
cluster_4.pdb ( medoid) 21.8418 5.12778 41.811 112
cluster_5.pdb ( medoid) 15.2568 7.14436 41.265 109
cluster_6.pdb ( medoid) 12.8732 5.6707 12.5812 73
cluster_7.pdb ( medoid) 8.37914 9.07014 44.8298 76
cluster_8.pdb ( medoid) 8.04747 8.94691 38.4361 72
cluster_9.pdb ( medoid) 4.1531 11.7984 35.7533 49
cluster_10.pdb ( medoid) 3.73197 21.1685 54.5739 79