CABS-dock: 1jbf

Project name: 1jbf

Status: done

submitted: 2025-12-12 13:29:42, status changed: 2025-12-12 17:02:50

Project settings

Protein sequence(s)	SSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHK input pdb
Peptide sequence	NLPRCTEGPWGWVCM
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCEEEEC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	25.8289	4.37494	27.2441	113
cluster_2.pdb ( medoid)	23.5912	6.99413	27.375	165
cluster_3.pdb ( medoid)	14.7655	6.9757	25.5557	103
cluster_4.pdb ( medoid)	14.5423	10.5898	28.0939	154
cluster_5.pdb ( medoid)	9.98765	11.2138	30.6572	112
cluster_6.pdb ( medoid)	6.63561	13.7139	28.4973	91
cluster_7.pdb ( medoid)	6.19086	10.6609	22.9517	66
cluster_8.pdb ( medoid)	4.98741	14.8374	30.8127	74
cluster_9.pdb ( medoid)	4.72587	11.6381	26.297	55
cluster_10.pdb ( medoid)	4.60933	14.5357	31.5923	67