Project name: 8TBP_VTLTYD_E2

Status: done

submitted: 2026-05-30 16:21:14, status changed: 2026-05-31 03:27:53

Project settings
Protein sequence(s) DTRPRFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVGESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLNGQEEKAGMVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA input pdb
Peptide sequence VTLTYDSEWQRDQFLSQVKI
Simulation mc cycles200
Peptide secondary structure psipred CCCCCCCHHHHHHHHHHCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 31.0582 4.25008 18.5341 132
cluster_2.pdb ( medoid) 23.7481 4.3793 13.5418 104
cluster_3.pdb ( medoid) 20.1173 4.67259 13.1825 94
cluster_4.pdb ( medoid) 19.5686 5.36574 27.5475 105
cluster_5.pdb ( medoid) 13.9434 7.96075 32.5699 111
cluster_6.pdb ( medoid) 11.6516 10.8998 22.905 127
cluster_7.pdb ( medoid) 11.3398 7.84846 16.4796 89
cluster_8.pdb ( medoid) 9.95093 11.3557 22.3846 113
cluster_9.pdb ( medoid) 8.40565 4.99664 18.8825 42
cluster_10.pdb ( medoid) 7.56211 10.9758 24.8695 83