CABS-dock: 8TBP_VTLTYD

Project name: 8TBP_VTLTYD_E2

Status: done

submitted: 2026-05-30 16:21:14, status changed: 2026-05-31 03:27:53

Project settings

Protein sequence(s)	DTRPRFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVGESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLNGQEEKAGMVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA input pdb
Peptide sequence	VTLTYDSEWQRDQFLSQVKI
Simulation mc cycles	200
Peptide secondary structure psipred	CCCCCCCHHHHHHHHHHCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	31.0582	4.25008	18.5341	132
cluster_2.pdb ( medoid)	23.7481	4.3793	13.5418	104
cluster_3.pdb ( medoid)	20.1173	4.67259	13.1825	94
cluster_4.pdb ( medoid)	19.5686	5.36574	27.5475	105
cluster_5.pdb ( medoid)	13.9434	7.96075	32.5699	111
cluster_6.pdb ( medoid)	11.6516	10.8998	22.905	127
cluster_7.pdb ( medoid)	11.3398	7.84846	16.4796	89
cluster_8.pdb ( medoid)	9.95093	11.3557	22.3846	113
cluster_9.pdb ( medoid)	8.40565	4.99664	18.8825	42
cluster_10.pdb ( medoid)	7.56211	10.9758	24.8695	83