Project name: 7NUI_YTAVSS_E2

Status: done

submitted: 2026-05-30 16:04:14, status changed: 2026-05-31 15:12:50

Project settings
Protein sequence(s) GSHSMRYFDTAMSRPGRGEPRFISSVGYVDDTQFVRFDSDAASPRMEPRAPWIEQEGPEYWDRNTQIFKTNTQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQDRAYLEGTCVEWLRRYLENGKDTLERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP input pdb
Peptide sequence YTAVSSTWHWTGHNVKH
Simulation mc cycles200
Peptide secondary structure psipred CCCCCCEEECCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 39.9984 3.27513 12.417 131
cluster_2.pdb ( medoid) 38.5334 3.97058 10.4486 153
cluster_3.pdb ( medoid) 19.204 2.6557 10.9629 51
cluster_4.pdb ( medoid) 18.9147 6.87298 18.9682 130
cluster_5.pdb ( medoid) 17.8658 6.60479 18.4596 118
cluster_6.pdb ( medoid) 12.5376 3.58921 10.6548 45
cluster_7.pdb ( medoid) 12.0916 6.20265 12.7276 75
cluster_8.pdb ( medoid) 11.8556 11.134 23.6692 132
cluster_9.pdb ( medoid) 11.2819 12.4979 32.1661 141
cluster_10.pdb ( medoid) 1.70434 14.0817 32.7555 24