Project name: MBTD1_YY1_repo_fasta _v1

Status: done

submitted: 2026-07-13 20:20:25, status changed: 2026-07-14 16:31:18

Project settings
Protein sequence(s) AVSMEGFSWGNYINSNSFIAAPVTCFKHAPMGTCWGDISENVRVEVPNTDCSLPTKVFWIAGIVKLAGYNALLRYEGFENDSGLDFWCNICGSDIHPVGWCAASGKPLVPPRTIQHKYTNWKAFLVKRLTGAKTLPPDFSQKVSESMQYPFKPCMRVEVVDKRHLCRTRVAVVESVIGGRLRLVYEESEDRTDDFWCHMHSPLIHHIGWSRSIGHRFKRSDDGHFDTPPHLFAKVKEVDQSGEWFKEGMKLEAIDPLNLSTICVATIRKVLADGFLMIGIDGSEAADGSDWFCYHATSPSIFPVGFCEINMIELTPPRGYTKLPFKWFDYLRETGSIAAPVKLFNKDVPNHGFRVGMKLEAVDLMEPRLICVATVTRIIHRLLRIHFDGWEEEYDQWVDCESPDLYPVGWCQLTGYQLQPPAS input pdb
Peptide sequence DPGNKKWEQKQVQIKTLEGEFSVTMWSSDE
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCEEEEEEEEECCEEEEEEEEECCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 63.3601 1.12058 2.09353 71
cluster_2.pdb ( medoid) 19.3626 5.57777 23.7305 108
cluster_3.pdb ( medoid) 13.7866 7.90621 60.8594 109
cluster_4.pdb ( medoid) 10.1235 3.06219 20.6252 31
cluster_5.pdb ( medoid) 8.34663 10.663 56.165 89
cluster_6.pdb ( medoid) 7.91638 14.2742 48.2065 113
cluster_7.pdb ( medoid) 7.51672 12.5055 26.0889 94
cluster_8.pdb ( medoid) 7.19449 14.0385 54.0254 101
cluster_9.pdb ( medoid) 6.52288 18.7034 66.5569 122
cluster_10.pdb ( medoid) 2.48063 16.1249 36.6557 40