CABS-dock: 248a390220260d0

Project name: 248a390220260d0

Status: done

submitted: 2026-03-18 09:17:44, status changed: 2026-03-18 22:47:23

Project settings

Protein sequence(s)	VKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFAPSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLDPGTAGPRVWYRPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQIGAYNYMEIGGTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKNCARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRIDLLSSLIYVSQN input pdb
Peptide sequence	RRRRVQLFGDNAYRR
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCEECCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	27.3882	4.23539	32.1367	116
cluster_2.pdb ( medoid)	17.5158	8.56368	23.2647	150
cluster_3.pdb ( medoid)	12.3463	8.0996	24.1253	100
cluster_4.pdb ( medoid)	10.8927	12.0263	44.1847	131
cluster_5.pdb ( medoid)	7.29895	9.1794	24.3703	67
cluster_6.pdb ( medoid)	5.50377	12.9002	28.5562	71
cluster_7.pdb ( medoid)	5.44605	10.4663	39.9096	57
cluster_8.pdb ( medoid)	4.99907	11.6022	29.4205	58
cluster_9.pdb ( medoid)	4.93778	15.7966	33.6928	78
cluster_10.pdb ( medoid)	3.29697	21.8382	42.2561	72