CABS-dock: 1250

Project name: 1250

Status: done

submitted: 2026-04-20 16:37:34, status changed: 2026-04-20 23:16:08

Project settings

Protein sequence(s)	MKTISVVTLLCVLPAVVYSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDSGYHSLDPNAVCETDKWKYENPCKKMCTVSDYVSELYDKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYMTINCDVGYEVIGVSYISCTANSWNVIPSCQQKCDIPSLSNGLISGSTFSIGGVIHLSCKSGFTLTGSPSSTCIDGKWNPILPTCVRSNEEFDPVDDGPDDETDLSKLSKDVVQYEQEIESLEATYHIIIMALTIMGVIFLISIIVLVCSCDKNNDQYKFHKLLP input pdb
Peptide sequence	HGLASTLTRWAHYNALFRAF
Simulation mc cycles	50
Peptide secondary structure psipred	CCCHHHHHHHHHHHHHHHHC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	40.1732	1.81713	9.00075	73
cluster_2.pdb ( medoid)	16.943	8.55812	23.8345	145
cluster_3.pdb ( medoid)	16.3006	7.1163	28.6512	116
cluster_4.pdb ( medoid)	12.9367	7.80728	24.1898	101
cluster_5.pdb ( medoid)	12.2551	3.99835	10.5781	49
cluster_6.pdb ( medoid)	10.5826	12.1898	28.1618	129
cluster_7.pdb ( medoid)	9.13377	7.66387	57.7993	70
cluster_8.pdb ( medoid)	7.65254	4.96567	29.5742	38
cluster_9.pdb ( medoid)	4.25964	11.5033	28.9281	49
cluster_10.pdb ( medoid)	1.9651	15.2664	30.3268	30