Project name: 1250

Status: done

submitted: 2026-04-20 16:37:34, status changed: 2026-04-20 23:16:08

Project settings
Protein sequence(s) MKTISVVTLLCVLPAVVYSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDSGYHSLDPNAVCETDKWKYENPCKKMCTVSDYVSELYDKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYMTINCDVGYEVIGVSYISCTANSWNVIPSCQQKCDIPSLSNGLISGSTFSIGGVIHLSCKSGFTLTGSPSSTCIDGKWNPILPTCVRSNEEFDPVDDGPDDETDLSKLSKDVVQYEQEIESLEATYHIIIMALTIMGVIFLISIIVLVCSCDKNNDQYKFHKLLP input pdb
Peptide sequence HGLASTLTRWAHYNALFRAF
Simulation mc cycles50
Peptide secondary structure psipred CCCHHHHHHHHHHHHHHHHC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 40.1732 1.81713 9.00075 73
cluster_2.pdb ( medoid) 16.943 8.55812 23.8345 145
cluster_3.pdb ( medoid) 16.3006 7.1163 28.6512 116
cluster_4.pdb ( medoid) 12.9367 7.80728 24.1898 101
cluster_5.pdb ( medoid) 12.2551 3.99835 10.5781 49
cluster_6.pdb ( medoid) 10.5826 12.1898 28.1618 129
cluster_7.pdb ( medoid) 9.13377 7.66387 57.7993 70
cluster_8.pdb ( medoid) 7.65254 4.96567 29.5742 38
cluster_9.pdb ( medoid) 4.25964 11.5033 28.9281 49
cluster_10.pdb ( medoid) 1.9651 15.2664 30.3268 30