CABS-dock: 29b823f50be8b63

Project name: 29b823f50be8b63

Status: done

submitted: 2026-07-23 13:50:35, status changed: 2026-07-23 15:48:43

Project settings

Protein sequence(s)	APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence	RRVIVFVQCGSNCR
Simulation mc cycles	50
Peptide secondary structure psipred	CEEEEEEEECCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	19.4819	6.00559	38.3569	117
cluster_2.pdb ( medoid)	18.9308	11.3572	35.4354	215
cluster_3.pdb ( medoid)	18.7152	8.01489	35.033	150
cluster_4.pdb ( medoid)	11.8988	11.3457	29.6626	135
cluster_5.pdb ( medoid)	5.89006	14.7706	34.1332	87
cluster_6.pdb ( medoid)	5.7199	13.4618	31.2624	77
cluster_7.pdb ( medoid)	5.29902	13.21	28.0897	70
cluster_8.pdb ( medoid)	4.92884	10.3473	32.0335	51
cluster_9.pdb ( medoid)	3.51753	13.9302	30.3592	49
cluster_10.pdb ( medoid)	3.48539	14.0587	31.6095	49