Project name: 29b823f50be8b63

Status: done

submitted: 2026-07-23 13:50:35, status changed: 2026-07-23 15:48:43

Project settings
Protein sequence(s) APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence RRVIVFVQCGSNCR
Simulation mc cycles50
Peptide secondary structure psipred CEEEEEEEECCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 19.4819 6.00559 38.3569 117
cluster_2.pdb ( medoid) 18.9308 11.3572 35.4354 215
cluster_3.pdb ( medoid) 18.7152 8.01489 35.033 150
cluster_4.pdb ( medoid) 11.8988 11.3457 29.6626 135
cluster_5.pdb ( medoid) 5.89006 14.7706 34.1332 87
cluster_6.pdb ( medoid) 5.7199 13.4618 31.2624 77
cluster_7.pdb ( medoid) 5.29902 13.21 28.0897 70
cluster_8.pdb ( medoid) 4.92884 10.3473 32.0335 51
cluster_9.pdb ( medoid) 3.51753 13.9302 30.3592 49
cluster_10.pdb ( medoid) 3.48539 14.0587 31.6095 49