Project name: LepB_3F_3

Status: done

submitted: 2026-06-03 03:10:01, status changed: 2026-06-03 09:44:41

Project settings
Protein sequence(s) RSFIYEPFQIPSGSMMPTLLIGDFILVEKFAYGIKDPIYQKTLIETGHPKRGDIVVFKYPEDPKLDYIKRAVGLPGDKVTYDPVSKELTIQPGCSSGQACENALPVTYSNVEPSDFVQTFSRRNGGEATSGFFEVPKNETKENGIRLSERKETLGDVTHRILTVPIAQDQVGMYYQQPGQQLATWIVPPGQYFMMGDNRDNSADSRYWGFVPEANLVGRATAIWMSFDGLRLSRIGGIH input pdb
Peptide sequence MLSFAADFFFEGDD
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 27.9662 4.5412 16.11 127
cluster_2.pdb ( medoid) 16.7352 9.20218 30.844 154
cluster_3.pdb ( medoid) 16.3656 9.65439 46.1668 158
cluster_4.pdb ( medoid) 13.7143 7.29168 17.9112 100
cluster_5.pdb ( medoid) 13.2375 10.2739 44.1932 136
cluster_6.pdb ( medoid) 11.3459 6.08149 15.7371 69
cluster_7.pdb ( medoid) 8.64425 10.5272 39.242 91
cluster_8.pdb ( medoid) 3.75636 13.577 34.1267 51
cluster_9.pdb ( medoid) 3.75077 16.53 62.3154 62
cluster_10.pdb ( medoid) 2.78993 18.6384 47.3537 52