CABS-dock: 31eba664b96bb38

Project name: 31eba664b96bb38

Status: done

submitted: 2026-01-14 04:47:29, status changed: 2026-01-14 06:48:32

Project settings

Protein sequence(s)	MVLSSDPPGPAAYRISDSSFVQCGSNCSMIIDGDVARGHLRDLEGATNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTMVLSSDPPGPAAYRISDSSFVQCGSNCSMIIDGDVARGHLRDLEGAT input pdb
Peptide sequence	RVIVQVFGSNCR
Simulation mc cycles	50
Peptide secondary structure psipred	CCEEEECCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	53.6343	1.51023	16.5675	81
cluster_2.pdb ( medoid)	18.8827	6.40798	21.0452	121
cluster_3.pdb ( medoid)	18.162	10.7367	24.3461	195
cluster_4.pdb ( medoid)	14.7418	10.3786	26.5887	153
cluster_5.pdb ( medoid)	10.6477	4.60194	19.0871	49
cluster_6.pdb ( medoid)	10.5865	6.99006	21.7314	74
cluster_7.pdb ( medoid)	9.52067	12.9193	28.7161	123
cluster_8.pdb ( medoid)	8.65094	7.39804	30.3066	64
cluster_9.pdb ( medoid)	6.19196	13.0815	27.7463	81
cluster_10.pdb ( medoid)	4.32477	13.6423	29.4839	59