CABS-dock: 34e93adfc7b2941

Project name: 34e93adfc7b2941

Status: done

submitted: 2026-01-21 14:58:59, status changed: 2026-01-22 01:41:10

Project settings

Protein sequence(s)	VYVELQELVMDEKNQELRWMEAARWVQLEENLGENGAWGRPHLSHLTFWSLLELRRVFTKGTVLLDLQETSLAGVANQLLDRFIFEDQIRPQDREELLRALLLKHSHAGELEALGGVKPAVLTRPSQPLLPQHSSLETQLFCEEKIPPDSEATLVLVGRADFLEQPVLGFVRLQEAAELEAVELPVPIRFLFVLLGPEAPHIDYTQLGRAAATLMSERVFRIDAYMAQSRGELLHSLEGFLDCSLVLPPTDAPSEQALLSLVPVQRELLRRRYQSS input pdb
Peptide sequence	VPSENDGTFTSNLTGHTKKT
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCEECCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	29.6935	5.05161	22.9232	150
cluster_2.pdb ( medoid)	21.2855	7.46987	41.1025	159
cluster_3.pdb ( medoid)	18.212	3.23963	10.3851	59
cluster_4.pdb ( medoid)	14.1161	6.16319	34.5185	87
cluster_5.pdb ( medoid)	13.6766	9.87088	28.7975	135
cluster_6.pdb ( medoid)	10.3438	9.76433	36.4337	101
cluster_7.pdb ( medoid)	9.90113	15.2508	46.9579	151
cluster_8.pdb ( medoid)	7.96802	9.41263	27.118	75
cluster_9.pdb ( medoid)	3.5707	16.5234	37.4603	59
cluster_10.pdb ( medoid)	1.82411	13.1571	39.9308	24