Project name: 365692796e2417e

Status: done

submitted: 2026-02-26 17:23:55, status changed: 2026-02-27 00:34:23

Project settings
Protein sequence(s) MERNSSLWKNLIDEHPVCTTWKQEAEGAIYHLASILFVVGFMGGSGFFGLLYVFSLLGLGFLCSAVWAWVDVCAADIFSWNFVLFVICFMQFVHIAYQVRSITFAREFQVLYSSLFQPLGISLPVFRTIALSSEVVTLEKEHCYAMQGKTSIDKLSLLVSGRIRVTVDGEFLHYIFPLQFLDSPEWDSLRPTEEGIFQVTLTAETDCRYVSWRRKKLYLLFAQHRYISRLFSVLIGSDIADKLYALNDRVYIGKRYHYDIRLPNFYQMSTPEIRRSPLTQHFQNSRRYCDK input pdb
Peptide sequence KQWLALEWKQ
Simulation mc cycles50
Peptide secondary structure psipred CCCEECEECC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 31.6995 3.88019 18.6975 123
cluster_2.pdb ( medoid) 26.6862 4.0845 12.6878 109
cluster_3.pdb ( medoid) 25.779 4.22824 13.7975 109
cluster_4.pdb ( medoid) 24.7947 3.58948 21.0527 89
cluster_5.pdb ( medoid) 18.0654 6.31042 14.3919 114
cluster_6.pdb ( medoid) 11.3992 5.26353 10.9891 60
cluster_7.pdb ( medoid) 10.9195 6.6853 14.2266 73
cluster_8.pdb ( medoid) 9.90495 5.14894 9.248 51
cluster_9.pdb ( medoid) 9.01622 12.7548 29.7481 115
cluster_10.pdb ( medoid) 8.90345 6.40201 12.7553 57