Project name: 38fdc887bf3121f

Status: done

submitted: 2026-03-13 11:33:10, status changed: 2026-03-13 23:31:49

Project settings
Protein sequence(s) VKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFAPSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLDPGTAGPRVWYRPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQIGAYNYMEIGGTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKNCARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRIDLLSSLIYVSQN input pdb
Peptide sequence RRRWKKVQLFGSNDA
Simulation mc cycles50
Peptide secondary structure psipred CCCCEEEEECCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 30.0128 3.53182 31.3532 106
cluster_2.pdb ( medoid) 25.1822 4.52701 37.3205 114
cluster_3.pdb ( medoid) 19.2914 5.70202 38.6225 110
cluster_4.pdb ( medoid) 16.2422 6.71093 26.8458 109
cluster_5.pdb ( medoid) 14.1066 8.01045 35.6331 113
cluster_6.pdb ( medoid) 11.6608 11.0627 30.0831 129
cluster_7.pdb ( medoid) 5.82545 16.3077 32.1275 95
cluster_8.pdb ( medoid) 5.70166 19.6434 62.4768 112
cluster_9.pdb ( medoid) 2.60792 25.3075 53.4264 66
cluster_10.pdb ( medoid) 2.44523 18.8121 45.111 46