CABS-dock: 38fdc887bf3121f

Project name: 38fdc887bf3121f

Status: done

submitted: 2026-03-13 11:33:10, status changed: 2026-03-13 23:31:49

Project settings

Protein sequence(s)	VKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFAPSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLDPGTAGPRVWYRPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQIGAYNYMEIGGTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKNCARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRIDLLSSLIYVSQN input pdb
Peptide sequence	RRRWKKVQLFGSNDA
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCEEEEECCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	30.0128	3.53182	31.3532	106
cluster_2.pdb ( medoid)	25.1822	4.52701	37.3205	114
cluster_3.pdb ( medoid)	19.2914	5.70202	38.6225	110
cluster_4.pdb ( medoid)	16.2422	6.71093	26.8458	109
cluster_5.pdb ( medoid)	14.1066	8.01045	35.6331	113
cluster_6.pdb ( medoid)	11.6608	11.0627	30.0831	129
cluster_7.pdb ( medoid)	5.82545	16.3077	32.1275	95
cluster_8.pdb ( medoid)	5.70166	19.6434	62.4768	112
cluster_9.pdb ( medoid)	2.60792	25.3075	53.4264	66
cluster_10.pdb ( medoid)	2.44523	18.8121	45.111	46