CABS-dock: 39baf97fc0e1645

Project name: 39baf97fc0e1645

Status: done

submitted: 2026-04-05 05:27:39, status changed: 2026-04-05 08:59:13

Project settings

Protein sequence(s)	KDVFGTSVYGQTVILTVSTSLSPRSEMRADDKFVNVTIVTILAETTSDNEKTVTEKINKAIRSSSSNFLNYDLTLRCDYYGCNQTADDCLNGLACDCKSDLQRPNPQSPFCVASSLKCPDACNAQHKQCLIKKSGGAPECACVPGYQEDANGNCQKCAFGYSGLDC input pdb
Peptide sequence	TSLSPRSEMRADDKFVNVTIVTILAETTSD
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCHHHHCCCCCCEEEEEEEEEEEECCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	36.254	2.75831	6.10769	100
cluster_2.pdb ( medoid)	30.8657	7.28964	25.2117	225
cluster_3.pdb ( medoid)	21.5078	5.2539	32.3361	113
cluster_4.pdb ( medoid)	17.2036	7.32406	32.7996	126
cluster_5.pdb ( medoid)	6.85598	13.7107	39.0827	94
cluster_6.pdb ( medoid)	5.6848	10.7304	30.4772	61
cluster_7.pdb ( medoid)	5.42176	10.8821	31.5294	59
cluster_8.pdb ( medoid)	4.94076	17.4062	40.5841	86
cluster_9.pdb ( medoid)	4.34056	16.8181	35.0168	73
cluster_10.pdb ( medoid)	2.98523	21.1039	43.5322	63