Project name: 39ff6d50809f855

Status: done

submitted: 2026-06-13 08:52:12, status changed: 2026-06-13 11:33:18

Project settings
Protein sequence(s) MVLSDKTPGSASYRISDNNFVQCGSNCTMIIDGDVVRGRPQDPGAAASPAMVLSDKTPGSASYRISDNNFVQCGSNCTMIIDGDVVRGRPQDPGAAASPA input pdb
Peptide sequence KRLVQVFGSNTYRLHHHHHHHHHHH
Simulation mc cycles50
Peptide secondary structure psipred CCEEEECCCCCEECCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 28.7143 3.9005 29.8337 112
cluster_2.pdb ( medoid) 20.4634 4.59358 22.105 94
cluster_3.pdb ( medoid) 20.3382 7.86696 31.3731 160
cluster_4.pdb ( medoid) 19.4957 6.36037 21.3363 124
cluster_5.pdb ( medoid) 13.9193 8.69299 24.339 121
cluster_6.pdb ( medoid) 11.6667 12.1714 31.7535 142
cluster_7.pdb ( medoid) 8.01178 10.2349 23.2458 82
cluster_8.pdb ( medoid) 7.99331 7.63138 18.0938 61
cluster_9.pdb ( medoid) 7.55459 5.55953 16.9719 42
cluster_10.pdb ( medoid) 4.96601 12.4849 24.6187 62