Project name: 3a2346cbdaba16b

Status: done

submitted: 2026-06-03 16:51:04, status changed: 2026-06-03 18:27:17

Project settings
Protein sequence(s) RSLTFYPAWLTVSEGANATFTCSLSNWSEDLMLNWNRLSPSNQTEKQAAFSNGLSQPVQDARFQIIQLPNRHDFHMNILDTRRNDSGIYLCGAISLHPKAKIEESPGAELVVTERI input pdb
Peptide sequence ISYGGADYK
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 29.0637 4.40412 22.0286 128
cluster_2.pdb ( medoid) 25.7803 5.62446 23.6825 145
cluster_3.pdb ( medoid) 24.9776 3.88348 11.4794 97
cluster_4.pdb ( medoid) 22.1889 5.04757 14.6558 112
cluster_5.pdb ( medoid) 16.2283 5.97721 19.3725 97
cluster_6.pdb ( medoid) 14.8775 6.11661 22.7381 91
cluster_7.pdb ( medoid) 10.7473 8.28115 21.9653 89
cluster_8.pdb ( medoid) 9.71622 9.67455 26.3554 94
cluster_9.pdb ( medoid) 7.27413 11.8227 28.9065 86
cluster_10.pdb ( medoid) 4.72326 12.9148 29.4376 61