CABS-dock: 3e7e776c5773dd1

Project name: 3e7e776c5773dd1

Status: done

submitted: 2026-07-10 09:03:28, status changed: 2026-07-10 11:55:10

Project settings

Protein sequence(s)	LNFRIRKDCTHWPNCCPSKRQDPTHEWLKRDTVLKFPGETTSLTHHPESCKASEDGPLNSRSISPWKYELDRDLNRLPQDLYHARCLCQHCVSLQTGSHMDPLGNSELLYHNQTVFYRRPCPGEQGAPDGYCLEQRLYRVSLACVCVRPRVMA input pdb
Peptide sequence	NGTYFCAKAGDDDYTWAGGSIDAWGHGTE
Simulation mc cycles	50
Peptide secondary structure psipred	CCCEEECCCCCCCCCCCCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	20.4292	5.38446	29.0569	110
cluster_2.pdb ( medoid)	16.0423	7.72957	34.125	124
cluster_3.pdb ( medoid)	14.7249	11.2055	30.1243	165
cluster_4.pdb ( medoid)	13.2022	9.24086	35.5871	122
cluster_5.pdb ( medoid)	10.2473	9.46588	25.6509	97
cluster_6.pdb ( medoid)	8.43774	15.881	33.0051	134
cluster_7.pdb ( medoid)	6.78781	12.6698	31.5911	86
cluster_8.pdb ( medoid)	5.58571	13.7852	31.0348	77
cluster_9.pdb ( medoid)	3.41452	15.2291	32.9868	52
cluster_10.pdb ( medoid)	2.03632	16.2057	41.655	33