Project name: 3e7e776c5773dd1

Status: done

submitted: 2026-07-10 09:03:28, status changed: 2026-07-10 11:55:10

Project settings
Protein sequence(s) LNFRIRKDCTHWPNCCPSKRQDPTHEWLKRDTVLKFPGETTSLTHHPESCKASEDGPLNSRSISPWKYELDRDLNRLPQDLYHARCLCQHCVSLQTGSHMDPLGNSELLYHNQTVFYRRPCPGEQGAPDGYCLEQRLYRVSLACVCVRPRVMA input pdb
Peptide sequence NGTYFCAKAGDDDYTWAGGSIDAWGHGTE
Simulation mc cycles50
Peptide secondary structure psipred CCCEEECCCCCCCCCCCCCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 20.4292 5.38446 29.0569 110
cluster_2.pdb ( medoid) 16.0423 7.72957 34.125 124
cluster_3.pdb ( medoid) 14.7249 11.2055 30.1243 165
cluster_4.pdb ( medoid) 13.2022 9.24086 35.5871 122
cluster_5.pdb ( medoid) 10.2473 9.46588 25.6509 97
cluster_6.pdb ( medoid) 8.43774 15.881 33.0051 134
cluster_7.pdb ( medoid) 6.78781 12.6698 31.5911 86
cluster_8.pdb ( medoid) 5.58571 13.7852 31.0348 77
cluster_9.pdb ( medoid) 3.41452 15.2291 32.9868 52
cluster_10.pdb ( medoid) 2.03632 16.2057 41.655 33