Project name: 43cc619c7774a5d

Status: done

submitted: 2026-04-14 06:21:17, status changed: 2026-04-14 14:03:09

Project settings
Protein sequence(s) GTNVNDKVTASNFKLEKTTFDPNQSGNTFMAANFTVTDKVKSGDYFTAKLPDSLTGNGDVDYSNSNNTMPIADIKSTNGDVVAKATYDILTKTYTFVFTDYVNNKENINGQFSLPLFTDRAKAPKSGTYDANINIADEMFNNKITYNYSSPIAGIDKPNGANISSQIIGVDTASGQNTYKQTVFVNPKQRVLGNTWVYIKGYQDKIEESSGKVSATDTKLRIFEVNDTSKLSESYYADPNDSNLKEVTDQFKNRIYYEHPNVASIKFGDITKTYVVLVEGHYDNTGKNLKTQVIQENVDPVTNRDYSIFGWNNENNVVVV input pdb
Peptide sequence VVIPIELR
Simulation mc cycles50
Peptide secondary structure psipred CCCEEECC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 37.8291 4.83754 14.3009 183
cluster_2.pdb ( medoid) 33.0839 2.62968 9.84785 87
cluster_3.pdb ( medoid) 32.2647 2.57247 8.85495 83
cluster_4.pdb ( medoid) 29.862 6.53005 21.7312 195
cluster_5.pdb ( medoid) 24.7834 4.43845 32.2399 110
cluster_6.pdb ( medoid) 16.6292 4.14933 9.88109 69
cluster_7.pdb ( medoid) 12.8632 6.608 29.1151 85
cluster_8.pdb ( medoid) 10.823 6.92968 15.0987 75
cluster_9.pdb ( medoid) 10.2902 5.63641 31.628 58
cluster_10.pdb ( medoid) 7.60716 7.23003 25.2288 55