Project name: 49c49ad937ed73c

Status: done

submitted: 2026-01-21 16:20:41, status changed: 2026-01-21 20:26:29

Project settings
Protein sequence(s) AMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVI input pdb
Peptide sequence FISYDGNNKYYADSVKG
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCEECCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 24.0534 5.86195 19.7733 141
cluster_2.pdb ( medoid) 19.0014 6.05217 16.8831 115
cluster_3.pdb ( medoid) 12.7645 8.3826 28.5847 107
cluster_4.pdb ( medoid) 12.6356 6.96444 19.4302 88
cluster_5.pdb ( medoid) 11.1776 8.67807 24.2704 97
cluster_6.pdb ( medoid) 9.77072 7.26661 21.3304 71
cluster_7.pdb ( medoid) 9.73785 9.55036 23.704 93
cluster_8.pdb ( medoid) 8.62426 11.0154 31.23 95
cluster_9.pdb ( medoid) 8.25887 11.6239 32.0255 96
cluster_10.pdb ( medoid) 7.85312 12.3518 31.5581 97