CABS-dock: 4cab43f666ac3e

Project name: 4cab43f666ac3e

Status: done

submitted: 2026-03-18 10:03:36, status changed: 2026-03-18 14:31:22

Project settings

Protein sequence(s)	VKDFLSQLRSSNRRFSIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPGPRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLAPSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK input pdb
Peptide sequence	RRRRVQLFGSNTYRR
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCEECCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	29.9614	3.73815	22.432	112
cluster_2.pdb ( medoid)	18.109	8.17273	39.9701	148
cluster_3.pdb ( medoid)	16.3796	10.0124	35.2862	164
cluster_4.pdb ( medoid)	7.64733	17.2609	44.5016	132
cluster_5.pdb ( medoid)	6.46619	15.4651	34.2121	100
cluster_6.pdb ( medoid)	6.07568	16.6237	42.7295	101
cluster_7.pdb ( medoid)	5.86062	8.36088	34.6144	49
cluster_8.pdb ( medoid)	5.85842	15.3625	45.3771	90
cluster_9.pdb ( medoid)	3.62982	16.5298	31.196	60
cluster_10.pdb ( medoid)	2.59937	16.9272	42.9341	44