Project name: 4ff125702e82b46

Status: done

submitted: 2026-06-02 11:12:29, status changed: 2026-06-02 19:16:57

Project settings
Protein sequence(s) DHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCIWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFN input pdb
Peptide sequence CCVPASYNPMVLIQKTDTGVSLQTYD
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCEEEEEECCCCEECEECC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 27.1805 4.59888 26.915 125
cluster_2.pdb ( medoid) 17.947 8.13504 40.6386 146
cluster_3.pdb ( medoid) 14.9731 3.87362 15.2262 58
cluster_4.pdb ( medoid) 14.8739 9.81587 25.6383 146
cluster_5.pdb ( medoid) 12.969 4.39509 16.4629 57
cluster_6.pdb ( medoid) 9.4976 11.3713 42.2853 108
cluster_7.pdb ( medoid) 9.46178 12.4712 41.5905 118
cluster_8.pdb ( medoid) 6.93762 10.6665 18.7963 74
cluster_9.pdb ( medoid) 5.89018 9.8469 19.6063 58
cluster_10.pdb ( medoid) 1.67382 16.1308 39.235 27