CABS-dock: 5094308f657e296

Project name: 5094308f657e296

Status: done

submitted: 2026-03-19 09:41:23, status changed: 2026-03-19 16:37:42

Project settings

Protein sequence(s)	VKDFLSQLRSSNRRFSIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPGPRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLAPSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK input pdb
Peptide sequence	KRLVQVFGSNTYRLK
Simulation mc cycles	50
Peptide secondary structure psipred	CCCEEECCCCCEECC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	19.5934	6.17555	40.1199	121
cluster_2.pdb ( medoid)	18.6859	6.9571	49.2738	130
cluster_3.pdb ( medoid)	14.4964	10.5544	39.9738	153
cluster_4.pdb ( medoid)	9.65444	13.3617	30.6105	129
cluster_5.pdb ( medoid)	8.60591	11.5037	28.469	99
cluster_6.pdb ( medoid)	5.80614	16.5342	39.6494	96
cluster_7.pdb ( medoid)	5.78827	16.067	36.6672	93
cluster_8.pdb ( medoid)	4.35923	13.5345	32.0454	59
cluster_9.pdb ( medoid)	3.92281	15.5501	34.893	61
cluster_10.pdb ( medoid)	3.57633	16.4974	37.0311	59