CABS-dock: 51e3d54ac410948

Project name: 51e3d54ac410948

Status: done

submitted: 2026-07-08 11:08:11, status changed: 2026-07-08 14:55:53

Project settings

Protein sequence(s)	GSHMMLEADLELERAADVRRWEEQAEISSGSSSPPILSSISIKNEEEEQTLGLLEDGAYRIKQKGILGYSQIGAGVYYKEGTFHTMWHVTRRRGAVLMHKGKRIEPSWADVKKDLISYGGGGWKLEGEWKEGEEVQVLLALEPGKNPRAVQTKPGLFKTNTGTIGAVSLDFSPGTSGSPIVDKKGKVVGLYGNGVVVVTRSGAYYVSAIAN input pdb
Peptide sequence	GRFTAIGIYAPRHGG
Simulation mc cycles	50
Peptide secondary structure psipred	CCEEEEEEECCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	33.7694	3.22778	11.9796	109
cluster_2.pdb ( medoid)	15.9278	15.0052	47.4401	239
cluster_3.pdb ( medoid)	11.3677	10.6442	39.742	121
cluster_4.pdb ( medoid)	9.53531	11.0117	39.2325	105
cluster_5.pdb ( medoid)	7.55502	10.9861	38.6425	83
cluster_6.pdb ( medoid)	7.45533	6.84075	27.3871	51
cluster_7.pdb ( medoid)	6.70877	15.204	40.7426	102
cluster_8.pdb ( medoid)	6.52795	13.9401	42.631	91
cluster_9.pdb ( medoid)	5.83366	9.77087	33.6613	57
cluster_10.pdb ( medoid)	3.34324	12.5626	29.792	42