Project name: 51e3d54ac410948

Status: done

submitted: 2026-07-08 11:08:11, status changed: 2026-07-08 14:55:53

Project settings
Protein sequence(s) GSHMMLEADLELERAADVRRWEEQAEISSGSSSPPILSSISIKNEEEEQTLGLLEDGAYRIKQKGILGYSQIGAGVYYKEGTFHTMWHVTRRRGAVLMHKGKRIEPSWADVKKDLISYGGGGWKLEGEWKEGEEVQVLLALEPGKNPRAVQTKPGLFKTNTGTIGAVSLDFSPGTSGSPIVDKKGKVVGLYGNGVVVVTRSGAYYVSAIAN input pdb
Peptide sequence GRFTAIGIYAPRHGG
Simulation mc cycles50
Peptide secondary structure psipred CCEEEEEEECCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 33.7694 3.22778 11.9796 109
cluster_2.pdb ( medoid) 15.9278 15.0052 47.4401 239
cluster_3.pdb ( medoid) 11.3677 10.6442 39.742 121
cluster_4.pdb ( medoid) 9.53531 11.0117 39.2325 105
cluster_5.pdb ( medoid) 7.55502 10.9861 38.6425 83
cluster_6.pdb ( medoid) 7.45533 6.84075 27.3871 51
cluster_7.pdb ( medoid) 6.70877 15.204 40.7426 102
cluster_8.pdb ( medoid) 6.52795 13.9401 42.631 91
cluster_9.pdb ( medoid) 5.83366 9.77087 33.6613 57
cluster_10.pdb ( medoid) 3.34324 12.5626 29.792 42