Project name: 52200740b7af145

Status: done

submitted: 2026-07-13 12:34:05, status changed: 2026-07-13 22:15:18

Project settings
Protein sequence(s) MDAVIKVIGVGGGGGNAVEHMVRERIEGVEFFAVNTDAQALRKTAVGQTIQIGSGITKGLGAGANPEVGRNAADEDRDALRAALEGADMVFIAAGMGGGTGTGAAPVVAEVAKDLGILTVAVVTKPFNFEGKKRMAFAEQGITELSKHVDSLITIPNDKLLLGRGISELDAFGAANDVLKGAVQGIAELITRPGLMNVDFADVRTVMSEMGYAMMGSGVASGEDRAEEAAEMAISSPLLEDIDLSGARGVLVNITAGFDLRLDEFETVGNTIRAFASDNATVVIGTSLDPDMNDELRVTVVATGIG input pdb
Peptide sequence RPLNFKMLRFWGQQQCRRPLYCRRR
Simulation mc cycles50
Peptide secondary structure psipred CCCCHHHEEECCCCCCCCCCEECCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 52.9688 3.02065 9.47326 160
cluster_2.pdb ( medoid) 21.8907 6.62382 14.2318 145
cluster_3.pdb ( medoid) 20.09 5.42559 25.6149 109
cluster_4.pdb ( medoid) 16.984 6.59446 21.5673 112
cluster_5.pdb ( medoid) 15.2106 7.23182 30.5062 110
cluster_6.pdb ( medoid) 11.4485 9.43353 21.5621 108
cluster_7.pdb ( medoid) 7.35384 14.0063 40.3358 103
cluster_8.pdb ( medoid) 6.66724 5.54953 10.6791 37
cluster_9.pdb ( medoid) 3.39004 23.0086 40.9689 78
cluster_10.pdb ( medoid) 2.66106 14.28 43.9516 38