Project name: 522a6f2d6158ca4

Status: done

submitted: 2026-03-12 07:56:44, status changed: 2026-03-12 11:34:36

Project settings
Protein sequence(s) APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence RRMKWKKVQLFGSNDA
Simulation mc cycles50
Peptide secondary structure psipred CCCCCEEEECCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 21.4042 6.02685 24.8789 129
cluster_2.pdb ( medoid) 15.9959 11.4404 46.3698 183
cluster_3.pdb ( medoid) 13.4882 12.1588 39.7697 164
cluster_4.pdb ( medoid) 8.97319 10.1413 28.7369 91
cluster_5.pdb ( medoid) 8.25558 10.2961 24.6091 85
cluster_6.pdb ( medoid) 8.18007 10.7579 24.3415 88
cluster_7.pdb ( medoid) 7.0665 14.0098 31.0662 99
cluster_8.pdb ( medoid) 3.87024 16.278 40.0974 63
cluster_9.pdb ( medoid) 3.16185 14.8647 34.653 47
cluster_10.pdb ( medoid) 3.1001 16.4511 36.4539 51