CABS-dock: 52b0a2e4f269588

Project name: 52b0a2e4f269588

Status: done

submitted: 2026-03-09 04:41:27, status changed: 2026-03-09 07:12:15

Project settings

Protein sequence(s)	APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence	VQLFGSNTA
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	24.3156	7.03253	24.5886	171
cluster_2.pdb ( medoid)	17.2048	7.2073	26.1819	124
cluster_3.pdb ( medoid)	16.9215	8.03711	31.5895	136
cluster_4.pdb ( medoid)	16.6491	8.34882	32.2194	139
cluster_5.pdb ( medoid)	9.3316	7.28707	19.7308	68
cluster_6.pdb ( medoid)	7.24898	11.5878	27.0533	84
cluster_7.pdb ( medoid)	6.60767	10.2911	21.9937	68
cluster_8.pdb ( medoid)	6.4434	11.019	22.9133	71
cluster_9.pdb ( medoid)	6.24055	12.1784	26.5853	76
cluster_10.pdb ( medoid)	5.8843	10.7065	25.4009	63