Project name: 1POZ edited structure_mm24

Status: done

submitted: 2025-06-03 14:11:36, status changed: 2025-06-03 17:02:14

Project settings
Protein sequence(s) AQIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDI input pdb
Peptide sequence KEEDKHLKFRISHEL
Simulation mc cycles50
Peptide secondary structure psipred CHHHHCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 27.0772 4.02553 36.831 109
cluster_2.pdb ( medoid) 26.6994 3.55813 23.2161 95
cluster_3.pdb ( medoid) 23.1664 5.6979 20.8668 132
cluster_4.pdb ( medoid) 18.37 7.89329 23.7553 145
cluster_5.pdb ( medoid) 15.3297 7.24086 21.3279 111
cluster_6.pdb ( medoid) 13.1291 5.78865 14.9304 76
cluster_7.pdb ( medoid) 8.71423 9.06563 26.5174 79
cluster_8.pdb ( medoid) 7.15928 13.8282 31.5387 99
cluster_9.pdb ( medoid) 7.09143 14.9476 34.2007 106
cluster_10.pdb ( medoid) 4.15159 11.5618 27.4777 48