Project name: CRVTARR06

Status: done

submitted: 2026-07-15 03:39:34, status changed: 2026-07-15 05:20:44

Project settings
Protein sequence(s) AFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNA input pdb
Peptide sequence CRVTARR
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 47.9735 4.06475 17.1451 195
cluster_2.pdb ( medoid) 31.8688 2.66718 7.6129 85
cluster_3.pdb ( medoid) 29.5355 4.36762 14.6942 129
cluster_4.pdb ( medoid) 24.5974 5.12249 15.4475 126
cluster_5.pdb ( medoid) 19.297 6.47769 26.5812 125
cluster_6.pdb ( medoid) 15.3041 10.2587 39.6927 157
cluster_7.pdb ( medoid) 8.74539 5.7173 27.9511 50
cluster_8.pdb ( medoid) 6.90822 8.54055 25.7554 59
cluster_9.pdb ( medoid) 3.18548 14.7544 34.0705 47
cluster_10.pdb ( medoid) 2.23683 12.0706 31.6772 27