Project name: 5726955165f26d9

Status: done

submitted: 2026-07-28 09:48:37, status changed: 2026-07-28 11:41:07

Project settings
Protein sequence(s) APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence FVQVGDNNY
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 23.9367 6.05763 32.5618 145
cluster_2.pdb ( medoid) 22.0593 8.25047 27.4154 182
cluster_3.pdb ( medoid) 14.2016 8.59059 29.8619 122
cluster_4.pdb ( medoid) 13.0559 9.49761 33.2225 124
cluster_5.pdb ( medoid) 12.4449 7.39259 17.501 92
cluster_6.pdb ( medoid) 5.82352 11.6768 28.4168 68
cluster_7.pdb ( medoid) 5.76144 12.844 27.6167 74
cluster_8.pdb ( medoid) 5.60493 14.8084 34.5051 83
cluster_9.pdb ( medoid) 5.02811 13.3251 29.3706 67
cluster_10.pdb ( medoid) 2.51329 17.1091 38.5335 43